Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330300.1 | internal | 238 | 3-716(+) |
Amino Acid sequence : | |||
SRRLLASILRSAAARRPRSPICSVPKPSPRPSPAGHFLHRFAAHYATTAAPAAPPSSKAAPSDGHNGKITDERTGKGAIGKICQVIGPIVDVRFDDGMPRILTALEVLNNDIRVVLEVFS HLGEGVVRCIAMDATEGLVRGQRVLNTGSPITVPVGRATLGRIMNVIGEPIDDRGEFSTEHFLPIHREAPSFAEQSTAQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMEL | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 25,256.893 | ||
Theoretical pI: | 9.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 45.012 | ||
aromaticity | 0.042 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.269 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330300.1 | internal | 238 | 3-716(+) |
Amino Acid sequence : | |||
SRRLLASILRSAAARRPRSPICSVPKPSPRPSPAGHFLHRFAAHYATTAAPAAPPSSKAAPSDGHNGKITDERTGKGAIGKICQVIGPIVDVRFDDGMPRILTALEVLNNDIRVVLEVFS HLGEGVVRCIAMDATEGLVRGQRVLNTGSPITVPVGRATLGRIMNVIGEPIDDRGEFSTEHFLPIHREAPSFAEQSTAQEILVTGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMEL | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 25,256.893 | ||
Theoretical pI: | 9.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 45.012 | ||
aromaticity | 0.042 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.269 | ||
sheet | 0.248 |