Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330302.1 | 5prime_partial | 165 | 816-319(-) |
Amino Acid sequence : | |||
KVRAGADGDDHPFELISFLSTLPKEVSSKQDVVDALFQHGFSKDVAQWVVTNLRQTRINGASSSSFSWIFDLNGIADMYQSYEDTNLWKLVEDVPRGVHINFLKAERSLHRWALEDLRRI HIAEEQAIEEGGGVEMHVLEDAGHWVHADNPDGLFRILSFSFQGF* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 15,644.758 | ||
Theoretical pI: | 5.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 51.814 | ||
aromaticity | 0.132 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.235 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330302.1 | complete | 136 | 166-576(+) |
Amino Acid sequence : | |||
MAYYCSSQLQNLRHIGSGFPITVNKEMRSLTQFQTELHCISRGGVFHIRCNLKSLEREGKNSKEPVWVVCMNPVTSIFEDMHFDSTALFDGLLLGYVDPAEVFQGPSMQTSFCFEEVYVY TSWNVFHELPEICVFI* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,644.758 | ||
Theoretical pI: | 5.242 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 51.814 | ||
aromaticity | 0.132 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.235 | ||
sheet | 0.221 |