Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330304.1	complete	205	203-820(+)
Amino Acid sequence :
MSLRPNARTEVRRSRYKVAVDAEEGRRRREDNMVEIRKNRREENLLKKRREGLQAQQLHSPVNVPQLDKKLESLPALIAGVWSKDGADQLESTTQFRKLLSIERNPPIEEVIQSGVVPRF VEFLARDDYAQLQFEAAWALTNIASGTSDNTKVVIDHGAVPIFVKLLSSPSDDVREQAVWALGNVAGDSPKCRDLGLGYGALMHY*
Physicochemical properties
Number of amino acids:		205
Molecular weight:		23,103.944
Theoretical pI:		8.684
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		69.788
aromaticity		0.059
GRAVY		-0.530
Secondary Structure Fraction
Helix		0.288
turn		0.220
sheet		0.283