| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330305.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| FFFNFLLFFCAFLLIFIFPEYSGELVRVPARMALLSDLGTEIVIPVCAVVGIVFSLVQWVFVSRVKLSPERAGDAPAKNGKNGYSDYLIEEEEGLNDQNVVAKCAEIQNAISEGATSFLF TEYRYVGIFMVAFAVLIFLFLGSVEGFSTSSQPCTYDKEKLCKPALATAFFSTLSFLLGAITSVLSGFLEMKIATYANARTTLEARK | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,841.317 | ||
| Theoretical pI: | 4.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 28.654 | ||
| aromaticity | 0.145 | ||
| GRAVY | 0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.208 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330305.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| FFFNFLLFFCAFLLIFIFPEYSGELVRVPARMALLSDLGTEIVIPVCAVVGIVFSLVQWVFVSRVKLSPERAGDAPAKNGKNGYSDYLIEEEEGLNDQNVVAKCAEIQNAISEGATSFLF TEYRYVGIFMVAFAVLIFLFLGSVEGFSTSSQPCTYDKEKLCKPALATAFFSTLSFLLGAITSVLSGFLEMKIATYANARTTLEARK | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,841.317 | ||
| Theoretical pI: | 4.977 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 28.654 | ||
| aromaticity | 0.145 | ||
| GRAVY | 0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.208 | ||
| sheet | 0.304 | ||