| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330319.1 | 5prime_partial | 213 | 1-642(+) |
Amino Acid sequence : | |||
| VRSHQRRANSEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVIGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFG DSSALAPGGVRIGAPAMTSRGLVEKDFEQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,317.496 | ||
| Theoretical pI: | 8.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 44.726 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.239 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330319.1 | 5prime_partial | 213 | 1-642(+) |
Amino Acid sequence : | |||
| VRSHQRRANSEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVIGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFG DSSALAPGGVRIGAPAMTSRGLVEKDFEQIAEFLHRAVSLTLKIQKEHGKLLKDFNKGLVNNKEIEELKADVEKFSASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,317.496 | ||
| Theoretical pI: | 8.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 44.726 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.239 | ||
| sheet | 0.291 | ||