Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330324.1 | complete | 156 | 19-489(+) |
Amino Acid sequence : | |||
MSVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVGLTDINMDPTTAKI TFKSIAGLSRTFPVDAFVVEEKVKTTAASGDLVKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,380.028 | ||
Theoretical pI: | 5.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 26.677 | ||
aromaticity | 0.077 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.154 | ||
sheet | 0.282 |