| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330334.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| GIGVETARVLALRNAHVIIAARNIEAANEAKTSILQQHPNARVDVLKLDLASIKSVKAFADNFLALGLPLNILINNAGIMFCPYQLSEDGIEIQFATNHIGHFYLTNLLLEKMKETAKSS GIQGRIVNLSSIAHRYTYRGGIAFRHINDKSRYNSKMAYGQSKLANILHANELTRRLQSEGVNITANSVHPGLINTNLFKHSGILIRVFRVVSHFIWKSVPQGAATTCYVALHPSLEGES GKYYVDCNECKARRLARNEALA | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 28,946.977 | ||
| Theoretical pI: | 9.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.237 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330334.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| GIGVETARVLALRNAHVIIAARNIEAANEAKTSILQQHPNARVDVLKLDLASIKSVKAFADNFLALGLPLNILINNAGIMFCPYQLSEDGIEIQFATNHIGHFYLTNLLLEKMKETAKSS GIQGRIVNLSSIAHRYTYRGGIAFRHINDKSRYNSKMAYGQSKLANILHANELTRRLQSEGVNITANSVHPGLINTNLFKHSGILIRVFRVVSHFIWKSVPQGAATTCYVALHPSLEGES GKYYVDCNECKARRLARNEALA | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 28,946.977 | ||
| Theoretical pI: | 9.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19160 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.237 | ||
| sheet | 0.279 | ||