Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330360.1	5prime_partial	184	1-555(+)
Amino Acid sequence :
KNPPKKTTQTAQMLTPKSPPAAAKCQSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLRQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTG VKSKEILIWITICDISIKDPESGKITFGTPTGISKAFPVSAFDEEEEEEVKRRDESGLEFRMCC*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		20,723.538
Theoretical pI:		8.254
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21220
Instability index:		58.314
aromaticity		0.071
GRAVY		-0.558
Secondary Structure Fraction
Helix		0.255
turn		0.207
sheet		0.234