| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330367.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
| RLQQNWGQKNWAKKIQEEWRILEKDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSTYPSIPPKVHYHSGGLRINPNLYNCGKVCLSLLNTWSGHGQEKWLPGKSTMLQ VLVSIQGLILNAKPYFNEPGYANLGGTKHGEEKSLEYNERTFIYSLQTMVYSMRRPPKHFEAYVSGHFCKVGRDVLVSCKAYLEGAQVGCLVRGGVQDVD | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 25,078.472 | ||
| Theoretical pI: | 8.728 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45630 | ||
| Instability index: | 31.202 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.255 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330367.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
| RLQQNWGQKNWAKKIQEEWRILEKDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSTYPSIPPKVHYHSGGLRINPNLYNCGKVCLSLLNTWSGHGQEKWLPGKSTMLQ VLVSIQGLILNAKPYFNEPGYANLGGTKHGEEKSLEYNERTFIYSLQTMVYSMRRPPKHFEAYVSGHFCKVGRDVLVSCKAYLEGAQVGCLVRGGVQDVD | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 25,078.472 | ||
| Theoretical pI: | 8.728 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45630 | ||
| Instability index: | 31.202 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.255 | ||
| sheet | 0.214 | ||