Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330367.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
RLQQNWGQKNWAKKIQEEWRILEKDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSTYPSIPPKVHYHSGGLRINPNLYNCGKVCLSLLNTWSGHGQEKWLPGKSTMLQ VLVSIQGLILNAKPYFNEPGYANLGGTKHGEEKSLEYNERTFIYSLQTMVYSMRRPPKHFEAYVSGHFCKVGRDVLVSCKAYLEGAQVGCLVRGGVQDVD | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 25,078.472 | ||
Theoretical pI: | 8.728 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45630 | ||
Instability index: | 31.202 | ||
aromaticity | 0.123 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.255 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330367.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
RLQQNWGQKNWAKKIQEEWRILEKDLPDTIFVRVYESRMDLLRAVIVGAEGTPYHDGLFFFDVFFPSTYPSIPPKVHYHSGGLRINPNLYNCGKVCLSLLNTWSGHGQEKWLPGKSTMLQ VLVSIQGLILNAKPYFNEPGYANLGGTKHGEEKSLEYNERTFIYSLQTMVYSMRRPPKHFEAYVSGHFCKVGRDVLVSCKAYLEGAQVGCLVRGGVQDVD | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 25,078.472 | ||
Theoretical pI: | 8.728 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45380 45630 | ||
Instability index: | 31.202 | ||
aromaticity | 0.123 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.255 | ||
sheet | 0.214 |