Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330370.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
HEVNMSVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVGLTDINMDPT TAKITFKSIAGLSRTFPVDAFVVEEKVKTTAASGDLVKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,859.515 | ||
Theoretical pI: | 5.704 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 26.260 | ||
aromaticity | 0.075 | ||
GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.156 | ||
sheet | 0.281 |