| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330373.1 | complete | 165 | 506-9(-) |
Amino Acid sequence : | |||
| MEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPK EITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,907.367 | ||
| Theoretical pI: | 4.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 37.117 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330373.1 | complete | 165 | 506-9(-) |
Amino Acid sequence : | |||
| MEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPK EITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,907.367 | ||
| Theoretical pI: | 4.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
| Instability index: | 37.117 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.212 | ||