| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330382.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
| DPKDPLVQSFLFFALSGTLWGSYRIVKYSGYAGDLSPQSALELLQGNENAVLVDIRPENIKVRDGVPDLRRVARFRYASVTLPEIDYSVKKLLKGGRDIEDTLLAAVIRNLKIVDDKSKV LVMDADGTRSKGVARALRKLGTKKAYLVQGGFRSWVTNGLRIKMLKPETALTIINEEAEAILEEFKPTPLKIIGYGMGFAAATYSVVEWEKTLQFVGVIALGQIVYRRVSSYRDVEDLKQ DLRLLLTPVRLGGRAIHGQL | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 11,478.212 | ||
| Theoretical pI: | 10.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.565 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.330 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330382.1 | complete | 106 | 578-258(-) |
Amino Acid sequence : | |||
| MIFNGVGLNSSKIASASSLIIVSAVSGFNILIRNPFVTQERKPPWTRYAFLVPSFLSALATPLERVPSASMTKTLDLSSTILRLRITAASNVSSISLPPFSNFFTE* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,478.212 | ||
| Theoretical pI: | 10.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.565 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.330 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330382.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
| DPKDPLVQSFLFFALSGTLWGSYRIVKYSGYAGDLSPQSALELLQGNENAVLVDIRPENIKVRDGVPDLRRVARFRYASVTLPEIDYSVKKLLKGGRDIEDTLLAAVIRNLKIVDDKSKV LVMDADGTRSKGVARALRKLGTKKAYLVQGGFRSWVTNGLRIKMLKPETALTIINEEAEAILEEFKPTPLKIIGYGMGFAAATYSVVEWEKTLQFVGVIALGQIVYRRVSSYRDVEDLKQ DLRLLLTPVRLGGRAIHGQL | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 11,478.212 | ||
| Theoretical pI: | 10.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.565 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.330 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330382.1 | complete | 106 | 578-258(-) |
Amino Acid sequence : | |||
| MIFNGVGLNSSKIASASSLIIVSAVSGFNILIRNPFVTQERKPPWTRYAFLVPSFLSALATPLERVPSASMTKTLDLSSTILRLRITAASNVSSISLPPFSNFFTE* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,478.212 | ||
| Theoretical pI: | 10.903 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 41.565 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.330 | ||
| sheet | 0.245 | ||