Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330387.1 | 5prime_partial | 244 | 1-735(+) |
Amino Acid sequence : | |||
LWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVIRRGVAHPNKIAVGGHSYGAFMTANLLAHAPNLFCCGIARSGAYNRTLTPFGFQSEDRTLWDAVNTYVEMSPFISA NKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESVMHVLWETDRWLQSYCVTNASEESNASEENASKTTSNVESTAVGAAGGVAEQSDDEPDSIHITH RSSL* | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 11,774.622 | ||
Theoretical pI: | 8.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 60.903 | ||
aromaticity | 0.106 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.240 | ||
sheet | 0.154 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330387.1 | 5prime_partial | 104 | 747-433(-) |
Amino Acid sequence : | |||
SQFISQRRPVCDVNAIRLVIGLLCNSSGSSNGCTFYVRCGFTRIFFRCIRFFTSISHTVTLQPPISFPENMHHTLTCCITMALEWKNNKAAKCTVSFQCIEESI* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,774.622 | ||
Theoretical pI: | 8.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 60.903 | ||
aromaticity | 0.106 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.240 | ||
sheet | 0.154 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330387.1 | 5prime_partial | 244 | 1-735(+) |
Amino Acid sequence : | |||
LWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVIRRGVAHPNKIAVGGHSYGAFMTANLLAHAPNLFCCGIARSGAYNRTLTPFGFQSEDRTLWDAVNTYVEMSPFISA NKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGYAARESVMHVLWETDRWLQSYCVTNASEESNASEENASKTTSNVESTAVGAAGGVAEQSDDEPDSIHITH RSSL* | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 11,774.622 | ||
Theoretical pI: | 8.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 60.903 | ||
aromaticity | 0.106 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.240 | ||
sheet | 0.154 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330387.1 | 5prime_partial | 104 | 747-433(-) |
Amino Acid sequence : | |||
SQFISQRRPVCDVNAIRLVIGLLCNSSGSSNGCTFYVRCGFTRIFFRCIRFFTSISHTVTLQPPISFPENMHHTLTCCITMALEWKNNKAAKCTVSFQCIEESI* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,774.622 | ||
Theoretical pI: | 8.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7490 | ||
Instability index: | 60.903 | ||
aromaticity | 0.106 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.240 | ||
sheet | 0.154 |