| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330390.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| DLIPLIESGVRGVTSNPAIFQKAISTSSAYNDQFKELVQSGKDIESAYWELVVKDIQDACKLFEPIYDETDGGDGYVSVEVSPRLADDTENTIEAAKWLHKWVNRSNVYIKIPATAACIP SIKEVIAKGISVNVTLIFSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKKGAKKQRLLWASTSV KNPAYPDTLYVAPLVGPDTVSTMPDQALQAFI | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 29,725.563 | ||
| Theoretical pI: | 5.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 29.076 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.213 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330390.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| DLIPLIESGVRGVTSNPAIFQKAISTSSAYNDQFKELVQSGKDIESAYWELVVKDIQDACKLFEPIYDETDGGDGYVSVEVSPRLADDTENTIEAAKWLHKWVNRSNVYIKIPATAACIP SIKEVIAKGISVNVTLIFSLARYEAVIDAYLDGLEASGLSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKKGAKKQRLLWASTSV KNPAYPDTLYVAPLVGPDTVSTMPDQALQAFI | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 29,725.563 | ||
| Theoretical pI: | 5.124 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 29.076 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.213 | ||
| sheet | 0.268 | ||