| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330404.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| HTQFRTNYSLFMPFYDYIHGTMDKSSDALHEASLHRMQDNPDVVHLTHLTTPDSIFHLQVGFGSFSSRPQQFKWYTWPLMWWSVVINYIYGKTFVVERNLLGKLRLQTWAIPRYTIQYSL KWQAQAVNCLIEEALLEAEVKGSRVLSLGLLNQSSGAALLQRHPKLNTKIVDGSSLAVAIVLNSIPQGTTQVMFRGGLSKLAFAIVSGLCEQGIEVATFYENEKLKLSARIQGKIVL | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 15,544.675 | ||
| Theoretical pI: | 11.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.385 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330404.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| HSIPDQLLLVHAVLRLHPWHHGQVERRLARGLAPPDARQSRRRASHSSNHTRLHLPPPSRIRFLLVQASTVQMVHVAPHVVVRRHQLHLRQNICCGEKSVGETQVANVGDPTLHHTVFSQ MASAGCQLLDRRSVAGSRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,544.675 | ||
| Theoretical pI: | 11.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.385 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330404.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| HTQFRTNYSLFMPFYDYIHGTMDKSSDALHEASLHRMQDNPDVVHLTHLTTPDSIFHLQVGFGSFSSRPQQFKWYTWPLMWWSVVINYIYGKTFVVERNLLGKLRLQTWAIPRYTIQYSL KWQAQAVNCLIEEALLEAEVKGSRVLSLGLLNQSSGAALLQRHPKLNTKIVDGSSLAVAIVLNSIPQGTTQVMFRGGLSKLAFAIVSGLCEQGIEVATFYENEKLKLSARIQGKIVL | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 15,544.675 | ||
| Theoretical pI: | 11.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.385 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330404.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| HSIPDQLLLVHAVLRLHPWHHGQVERRLARGLAPPDARQSRRRASHSSNHTRLHLPPPSRIRFLLVQASTVQMVHVAPHVVVRRHQLHLRQNICCGEKSVGETQVANVGDPTLHHTVFSQ MASAGCQLLDRRSVAGSRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,544.675 | ||
| Theoretical pI: | 11.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.385 | ||
| aromaticity | 0.022 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.230 | ||
| sheet | 0.230 | ||