Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330406.1 | 5prime_partial | 243 | 1-732(+) |
Amino Acid sequence : | |||
VELDISQPTVQITDLKFTYPGIDGHPPPGAKPLIDHFSLSLFAGQRCLLVGSNGAGKTTILKIIGGKHMVQQDMVRVLGRSAFHDTSLVASGDLSYLGGEWRREVAFAGFDVPIQMDVSA DKMIFGVSGVDPKRRDELIKVLGVDLSWRLHKVSDGQRRRVQICMGLLKPFKVLLLDEITVDLDVLARADLLRFLKKECEERGATIIYATHIFDGLEDWPSHIVYVAHGKLQLAMPMNKN QGD* | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 26,928.957 | ||
Theoretical pI: | 6.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 36.147 | ||
aromaticity | 0.070 | ||
GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.206 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330406.1 | 5prime_partial | 243 | 1-732(+) |
Amino Acid sequence : | |||
VELDISQPTVQITDLKFTYPGIDGHPPPGAKPLIDHFSLSLFAGQRCLLVGSNGAGKTTILKIIGGKHMVQQDMVRVLGRSAFHDTSLVASGDLSYLGGEWRREVAFAGFDVPIQMDVSA DKMIFGVSGVDPKRRDELIKVLGVDLSWRLHKVSDGQRRRVQICMGLLKPFKVLLLDEITVDLDVLARADLLRFLKKECEERGATIIYATHIFDGLEDWPSHIVYVAHGKLQLAMPMNKN QGD* | |||
Physicochemical properties | |||
Number of amino acids: | 243 | ||
Molecular weight: | 26,928.957 | ||
Theoretical pI: | 6.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 36.147 | ||
aromaticity | 0.070 | ||
GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.206 | ||
sheet | 0.243 |