| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330414.1 | 5prime_partial | 245 | 3-740(+) |
Amino Acid sequence : | |||
| KTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGV EFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRL AQSFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 17,302.675 | ||
| Theoretical pI: | 6.342 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 50.547 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330414.1 | 5prime_partial | 153 | 833-372(-) |
Amino Acid sequence : | |||
| EKWDPFALQVSAFSKVALQESPEQGDEIAVVLIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEG HYAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,302.675 | ||
| Theoretical pI: | 6.342 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 50.547 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330414.1 | 5prime_partial | 245 | 3-740(+) |
Amino Acid sequence : | |||
| KTMFTTLLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGV EFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRL AQSFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 17,302.675 | ||
| Theoretical pI: | 6.342 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 50.547 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330414.1 | 5prime_partial | 153 | 833-372(-) |
Amino Acid sequence : | |||
| EKWDPFALQVSAFSKVALQESPEQGDEIAVVLIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEG HYAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 17,302.675 | ||
| Theoretical pI: | 6.342 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 50.547 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.183 | ||
| sheet | 0.294 | ||