Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330418.1 | 5prime_partial | 161 | 2-487(+) |
Amino Acid sequence : | |||
RMKKAKSSKQQNKFYHVITIPIRALCKARDFYVRNMLDCANSNAIGLQATAQTSSLPRSFSAASSRSYNDDRDDYRDLVRAASARSIGVRLDVEAYLKQERVRAGPKRSASVAMGRIDED RASNYFGEDVKNGNEIVGNNRKNSDLKYPRSKSDVVTRTSF* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 11,594.786 | ||
Theoretical pI: | 10.315 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 83.041 | ||
aromaticity | 0.080 | ||
GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
Helix | 0.120 | ||
turn | 0.350 | ||
sheet | 0.140 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330418.1 | complete | 100 | 482-180(-) |
Amino Acid sequence : | |||
MMFLSQHHFCFLDTSNHYSSYYCQQSHSHSSHLHQSNCSPCPHRFCPSQRSRFSSARPEPSPASSTPRHRAEPRCSGPRRPERDLGSHRGRRCTTAMRPR* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,594.786 | ||
Theoretical pI: | 10.315 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
Instability index: | 83.041 | ||
aromaticity | 0.080 | ||
GRAVY | -1.226 | ||
Secondary Structure Fraction | |||
Helix | 0.120 | ||
turn | 0.350 | ||
sheet | 0.140 |