| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330419.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| RRTTNHPLSTKPSHFHTHANPNRRRLHVNSAADQNQTTTDASAGKLDRRNMLLGLGGLYGATNLFSVPTASAAPVLAPDFDKCGPVSDANSGQVLEGVDCCLITEEIADYKLPPSVMKFR PPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSQIYDEK REPT | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,437.821 | ||
| Theoretical pI: | 8.568 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 49.013 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.270 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330419.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| RRTTNHPLSTKPSHFHTHANPNRRRLHVNSAADQNQTTTDASAGKLDRRNMLLGLGGLYGATNLFSVPTASAAPVLAPDFDKCGPVSDANSGQVLEGVDCCLITEEIADYKLPPSVMKFR PPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSQIYDEK REPT | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 27,437.821 | ||
| Theoretical pI: | 8.568 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 49.013 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.270 | ||
| sheet | 0.217 | ||