Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330419.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
RRTTNHPLSTKPSHFHTHANPNRRRLHVNSAADQNQTTTDASAGKLDRRNMLLGLGGLYGATNLFSVPTASAAPVLAPDFDKCGPVSDANSGQVLEGVDCCLITEEIADYKLPPSVMKFR PPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSQIYDEK REPT | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,437.821 | ||
Theoretical pI: | 8.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
Instability index: | 49.013 | ||
aromaticity | 0.107 | ||
GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.270 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330419.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
RRTTNHPLSTKPSHFHTHANPNRRRLHVNSAADQNQTTTDASAGKLDRRNMLLGLGGLYGATNLFSVPTASAAPVLAPDFDKCGPVSDANSGQVLEGVDCCLITEEIADYKLPPSVMKFR PPAHRVTPEYVAKYNLAIKRMKELPDTDPRSFMNQANIHCAYCNTAYKQGGGDGTVPLQIHNSWLFFPFHRWYLYFYERILGQLIGDPTFALPFWNWDNPKGMTIPPMFNIVGSQIYDEK REPT | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,437.821 | ||
Theoretical pI: | 8.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
Instability index: | 49.013 | ||
aromaticity | 0.107 | ||
GRAVY | -0.477 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.270 | ||
sheet | 0.217 |