| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330425.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| LTEHYTVAAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGLAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKESTVNAYKKQFQSDLGAFL RSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKGDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTG GLVDAHIGDQLGHELFSRL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,704.859 | ||
| Theoretical pI: | 4.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 46.619 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.266 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330425.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| LTEHYTVAAEEPPEFSAFFCDLPSNDFNTLFQLLPPSDGSSGSYFTAGLAGSFYRRLFPAKSVDFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTIHGAKESTVNAYKKQFQSDLGAFL RSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKGDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTG GLVDAHIGDQLGHELFSRL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 28,704.859 | ||
| Theoretical pI: | 4.984 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 46.619 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.266 | ||
| sheet | 0.263 | ||