| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330452.1 | complete | 181 | 55-600(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPWGTPPQPQPLTHRPPRKKRRRPPSSQSWG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 16,880.039 | ||
| Theoretical pI: | 6.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 40.592 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.204 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330452.1 | 5prime_partial | 152 | 664-206(-) |
Amino Acid sequence : | |||
| AMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCPKTETTVAYDVSFVGAGGSKAEAVAVCPRDTAEWNP KHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,880.039 | ||
| Theoretical pI: | 6.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 40.592 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.204 | ||
| sheet | 0.224 | ||