| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330453.1 | 3prime_partial | 261 | 33-815(+) |
Amino Acid sequence : | |||
| MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSR KPSDKPVVVCHQQEYEYAVFY | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,462.487 | ||
| Theoretical pI: | 10.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.293 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.185 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330453.1 | 5prime_partial | 108 | 815-489(-) |
Amino Acid sequence : | |||
| VKHSIFILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,462.487 | ||
| Theoretical pI: | 10.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.293 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.185 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330453.1 | 3prime_partial | 261 | 33-815(+) |
Amino Acid sequence : | |||
| MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSR KPSDKPVVVCHQQEYEYAVFY | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,462.487 | ||
| Theoretical pI: | 10.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.293 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.185 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330453.1 | 5prime_partial | 108 | 815-489(-) |
Amino Acid sequence : | |||
| VKHSIFILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,462.487 | ||
| Theoretical pI: | 10.026 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 37.293 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.435 | ||
| turn | 0.185 | ||
| sheet | 0.231 | ||