Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330453.1	3prime_partial	261	33-815(+)
Amino Acid sequence :
MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSR KPSDKPVVVCHQQEYEYAVFY
Physicochemical properties
Number of amino acids:		261
Molecular weight:		12,462.487
Theoretical pI:		10.026
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		37.293
aromaticity		0.111
GRAVY		0.248
Secondary Structure Fraction
Helix		0.435
turn		0.185
sheet		0.231

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330453.1	5prime_partial	108	815-489(-)
Amino Acid sequence :
VKHSIFILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,462.487
Theoretical pI:		10.026
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		37.293
aromaticity		0.111
GRAVY		0.248
Secondary Structure Fraction
Helix		0.435
turn		0.185
sheet		0.231

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330453.1	3prime_partial	261	33-815(+)
Amino Acid sequence :
MEFKNLSILAFLSVAIVVCHAALPSEEYWNSALPNTVMPKSVKDLLTDDKSGVNVGVNVGHGHDKDKDHDHDKDKDHDHDKDHGGSHKNHKPVNVNVSPFIYHYAATETQLHDSPNVALF FLEKDLYAGNKMTLQFYKDTNQQKFLTRHVADSIPFSSDKLPEIYTKFLVDPDSDEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSR KPSDKPVVVCHQQEYEYAVFY
Physicochemical properties
Number of amino acids:		261
Molecular weight:		12,462.487
Theoretical pI:		10.026
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		37.293
aromaticity		0.111
GRAVY		0.248
Secondary Structure Fraction
Helix		0.435
turn		0.185
sheet		0.231

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330453.1	5prime_partial	108	815-489(-)
Amino Acid sequence :
VKHSIFILLLVANHHRLVARLPRHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLLLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		12,462.487
Theoretical pI:		10.026
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		37.293
aromaticity		0.111
GRAVY		0.248
Secondary Structure Fraction
Helix		0.435
turn		0.185
sheet		0.231