| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330459.1 | 5prime_partial | 222 | 1-669(+) |
Amino Acid sequence : | |||
| SLTTTIPESATAMNQLSRASMKWSRLIGARYPSSAAAVTPKPFSTEASEQFPQTPSAGIVYGRLPDISKHTTKSDVINLLDESNLAPEKLRIEYNRAFFPLSMLIEFPSASAYDASVRSI GRNGRLYNIRRADRADWDVCQVHDGKAVVLVGIPRIAALDDVERFLSGCNPSSIQFSVRPTNEGSVRMAVVRFPSRALAMHAYITKNRGFCLNNQITVQVLH* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,499.673 | ||
| Theoretical pI: | 9.577 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 38.802 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.266 | ||
| sheet | 0.243 | ||