| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330461.1 | 3prime_partial | 233 | 74-772(+) |
Amino Acid sequence : | |||
| MLRVAGKRLSSLSWRPPQSSPAAFFSRNSIVGGDSPSDGRTGTASSPVHSIPLLDQIRGFSSGTLAPGQDAGLVSGIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWF | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 13,092.788 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.234 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.300 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330461.1 | complete | 120 | 735-373(-) |
Amino Acid sequence : | |||
| MQPRWVQTPTTTSHSGFLTLTASSCGSRREAMSTLFASLMSSSVRRLMKTGFPRHFTVTVVPGSILERSTSRDARARTSLLADMLNTNLSTRSRANDAYTNLPPVRTKYANARLLGSPGG * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,092.788 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.234 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.300 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330461.1 | 3prime_partial | 233 | 74-772(+) |
Amino Acid sequence : | |||
| MLRVAGKRLSSLSWRPPQSSPAAFFSRNSIVGGDSPSDGRTGTASSPVHSIPLLDQIRGFSSGTLAPGQDAGLVSGIPATVAAIKNPSPKIVYDEHNHERYPPGDPSKRAFAYFVLTGGR FVYASLARLLVLKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDIKLANSVDIASLRDPQEDAVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWF | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 13,092.788 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.234 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.300 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330461.1 | complete | 120 | 735-373(-) |
Amino Acid sequence : | |||
| MQPRWVQTPTTTSHSGFLTLTASSCGSRREAMSTLFASLMSSSVRRLMKTGFPRHFTVTVVPGSILERSTSRDARARTSLLADMLNTNLSTRSRANDAYTNLPPVRTKYANARLLGSPGG * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,092.788 | ||
| Theoretical pI: | 11.754 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 61.234 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.225 | ||
| turn | 0.300 | ||
| sheet | 0.250 | ||