| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330466.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| TLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQ GVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKKKTCPWLRPDGKTQVTV | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,679.197 | ||
| Theoretical pI: | 5.090 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 41.990 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.206 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330466.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| TLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQ GVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKKKTCPWLRPDGKTQVTV | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,679.197 | ||
| Theoretical pI: | 5.090 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 41.990 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.206 | ||
| sheet | 0.233 | ||