Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330469.1 | complete | 234 | 42-746(+) |
Amino Acid sequence : | |||
MXWGDYFLAYTSQLTEISRVEKEEHERQKEGVRNLLTQTPDDSSLKLQLIDSIQRLGVGYHFEKEIQESLKFIYHHTKDHPLRILALRFRLMRQQGFHVPCDVFKRFIDEDGNFMESIKD DVEVMLSLYEASNYGVHGEEILEKALEFCSSRLESLLLGQTMNDSLLMRVKEALRIPISRTLTRFGARKFISEYQDNNSTLHDETLLKFAISDFNMLQKIHQRELSQLTRWWKE* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 27,606.165 | ||
Theoretical pI: | 5.885 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 36.550 | ||
aromaticity | 0.099 | ||
GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.167 | ||
sheet | 0.292 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330469.1 | complete | 234 | 42-746(+) |
Amino Acid sequence : | |||
MXWGDYFLAYTSQLTEISRVEKEEHERQKEGVRNLLTQTPDDSSLKLQLIDSIQRLGVGYHFEKEIQESLKFIYHHTKDHPLRILALRFRLMRQQGFHVPCDVFKRFIDEDGNFMESIKD DVEVMLSLYEASNYGVHGEEILEKALEFCSSRLESLLLGQTMNDSLLMRVKEALRIPISRTLTRFGARKFISEYQDNNSTLHDETLLKFAISDFNMLQKIHQRELSQLTRWWKE* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 27,606.165 | ||
Theoretical pI: | 5.885 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 36.550 | ||
aromaticity | 0.099 | ||
GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.167 | ||
sheet | 0.292 |