| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330472.1 | complete | 188 | 232-798(+) |
Amino Acid sequence : | |||
| MDKAVDTVYQPGKKFVEEKRDSVIDIELTDTTELWLVQWPINQGPDINGQCVSLKLQGDGHIGAFECSSGKSYEMLSMKSQGPQETVFLNSVSEAKIAGKISRHVSLIHYPEPSELQKHD NENPSEPPRSSSLTSSTFSGRRSKPRISQVRSSYSTPSSRTKSMVTGMSEPSKGSKRKHVSDGHSDQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,741.859 | ||
| Theoretical pI: | 7.796 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 63.413 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
| Helix | 0.218 | ||
| turn | 0.335 | ||
| sheet | 0.170 | ||