Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330472.1 | complete | 188 | 232-798(+) |
Amino Acid sequence : | |||
MDKAVDTVYQPGKKFVEEKRDSVIDIELTDTTELWLVQWPINQGPDINGQCVSLKLQGDGHIGAFECSSGKSYEMLSMKSQGPQETVFLNSVSEAKIAGKISRHVSLIHYPEPSELQKHD NENPSEPPRSSSLTSSTFSGRRSKPRISQVRSSYSTPSSRTKSMVTGMSEPSKGSKRKHVSDGHSDQS* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,741.859 | ||
Theoretical pI: | 7.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 63.413 | ||
aromaticity | 0.053 | ||
GRAVY | -0.820 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.335 | ||
sheet | 0.170 |