| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330485.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| SSTSVDSRELAVNSAFLHNPKLLFAPKTRKTTIQRCGYKAPVARKSLDHIPKQFREENLKDGLMENYKNAPQYLYGLTPSQMDMFMTEDNPVRRQSEKVTEESISSACNYLNHGGMWSMS GHNERGPSKYSMSVSMYRGGARGYGRPRTAPPDLPSLLLDARIVYLGMPIVPAVTELLVAQFMWLDYDSPTKPIYLYINSSGTQNEKMETVGSETEAYAIADTMAYCKADVYTVNCGMAY GQAAMLLSLGAKGFRGLQPNSST | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 29,191.940 | ||
| Theoretical pI: | 8.539 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34840 35090 | ||
| Instability index: | 47.651 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.281 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330485.1 | internal | 263 | 3-791(+) |
Amino Acid sequence : | |||
| SSTSVDSRELAVNSAFLHNPKLLFAPKTRKTTIQRCGYKAPVARKSLDHIPKQFREENLKDGLMENYKNAPQYLYGLTPSQMDMFMTEDNPVRRQSEKVTEESISSACNYLNHGGMWSMS GHNERGPSKYSMSVSMYRGGARGYGRPRTAPPDLPSLLLDARIVYLGMPIVPAVTELLVAQFMWLDYDSPTKPIYLYINSSGTQNEKMETVGSETEAYAIADTMAYCKADVYTVNCGMAY GQAAMLLSLGAKGFRGLQPNSST | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 29,191.940 | ||
| Theoretical pI: | 8.539 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34840 35090 | ||
| Instability index: | 47.651 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.281 | ||
| sheet | 0.274 | ||