| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330488.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| ATKSAPPPAAKWDPETWKTKNALQLPEYPDEAELESVLKTMEAYPPLVFAGEVRSLEERLAEAAVGKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQF AKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPHRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDEALGFMEAAGLTIDHPVMSTTEFWTS HECLLL | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,415.720 | ||
| Theoretical pI: | 5.066 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 40.951 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.365 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.211 | ||
| sheet | 0.325 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330488.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| ATKSAPPPAAKWDPETWKTKNALQLPEYPDEAELESVLKTMEAYPPLVFAGEVRSLEERLAEAAVGKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQF AKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPHRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDEALGFMEAAGLTIDHPVMSTTEFWTS HECLLL | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,415.720 | ||
| Theoretical pI: | 5.066 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 40.951 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.365 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.211 | ||
| sheet | 0.325 | ||