| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330493.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| SSCTWVATAAVIDDRPSCVRYPRGNGVGAALPLNNKGVPLEVGKGRILKEGSRVAILGFGTIVQNCLAAANLLQEHGISVSVADARFCKPLDGDLIKNLVKDHEILITVEEGSIGGFSAH VSHFLSLNGLLDGNLKWRPMVLPDRYIDHGAHPDQIEAAGLSSKHIAGTVLSLIEGKESLCHLI | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,516.238 | ||
| Theoretical pI: | 6.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 27.847 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.272 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330493.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| SSCTWVATAAVIDDRPSCVRYPRGNGVGAALPLNNKGVPLEVGKGRILKEGSRVAILGFGTIVQNCLAAANLLQEHGISVSVADARFCKPLDGDLIKNLVKDHEILITVEEGSIGGFSAH VSHFLSLNGLLDGNLKWRPMVLPDRYIDHGAHPDQIEAAGLSSKHIAGTVLSLIEGKESLCHLI | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,516.238 | ||
| Theoretical pI: | 6.424 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 27.847 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.272 | ||
| sheet | 0.266 | ||