Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330495.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
EQPQLVLAHNLFLLTQNDVDDIEKVRLRHEVFNFIVANDMAPLYENLVASKVLDLDQKALDLMRSKIDDELKKLEEKIVDAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKTTESK TVAIGQKMDLVFNTLLIGFFHLDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAATLFLDSISTFTTYELFPYDTFIFYTCLTSIISLDRVSLKQKVVDAPEILTVI GKIPYLSDFLNSLYDCHYK | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 29,943.101 | ||
Theoretical pI: | 5.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20525 | ||
Instability index: | 32.676 | ||
aromaticity | 0.104 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.151 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330495.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
EQPQLVLAHNLFLLTQNDVDDIEKVRLRHEVFNFIVANDMAPLYENLVASKVLDLDQKALDLMRSKIDDELKKLEEKIVDAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKTTESK TVAIGQKMDLVFNTLLIGFFHLDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAATLFLDSISTFTTYELFPYDTFIFYTCLTSIISLDRVSLKQKVVDAPEILTVI GKIPYLSDFLNSLYDCHYK | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 29,943.101 | ||
Theoretical pI: | 5.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20525 | ||
Instability index: | 32.676 | ||
aromaticity | 0.104 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.151 | ||
sheet | 0.293 |