Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330496.1 | complete | 181 | 57-602(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 17,255.377 | ||
Theoretical pI: | 6.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.735 | ||
aromaticity | 0.071 | ||
GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.187 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330496.1 | 5prime_partial | 155 | 675-208(-) |
Amino Acid sequence : | |||
EAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAE WNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,255.377 | ||
Theoretical pI: | 6.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
Instability index: | 43.735 | ||
aromaticity | 0.071 | ||
GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.187 | ||
sheet | 0.245 |