| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330500.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| SIFEIGESDLSRLLEKPKHVNIERKRSFDERSFSELSISSPPRHFYKNNENSSRVFDNFGAVHSPVRSGVSTPRSFYCVETHPILSEAWAALQRSIVHFRGQPVRTIAALDHSTEQLNYD QVFVRDFVPTALAFLMNGEPDIVKNFLQKTLPLLSWEKKVDNFTLGAGVMPASFKVL | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,124.600 | ||
| Theoretical pI: | 7.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 53.840 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.266 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330500.1 | internal | 177 | 1-531(+) |
Amino Acid sequence : | |||
| SIFEIGESDLSRLLEKPKHVNIERKRSFDERSFSELSISSPPRHFYKNNENSSRVFDNFGAVHSPVRSGVSTPRSFYCVETHPILSEAWAALQRSIVHFRGQPVRTIAALDHSTEQLNYD QVFVRDFVPTALAFLMNGEPDIVKNFLQKTLPLLSWEKKVDNFTLGAGVMPASFKVL | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,124.600 | ||
| Theoretical pI: | 7.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 53.840 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.266 | ||
| sheet | 0.226 | ||