| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330503.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
| ARARVLGGGTSINAGFYTRASASEVEKAGWDAELVNESYPWIEKQIVHRPDFGPWQRAIRDSLLEVGISPFNGFTYDHLYGTKVGGTIFDRFGRRHTAAELLASSNPRNIHVLVRATVQK IEFDTTGKKPKAVGVIFKDEDGKTHRASLSKRVRSEIIVSCGAIGSPQMLLLSGIGPKSELEKFNIPVVVDNPFVGKNMSDNPLNTIFVPSSTPVNFSLIQTVGITKEGVYIESSSGYGQ SKDSIHCD | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,067.333 | ||
| Theoretical pI: | 8.810 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 44.263 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.290 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330503.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
| ARARVLGGGTSINAGFYTRASASEVEKAGWDAELVNESYPWIEKQIVHRPDFGPWQRAIRDSLLEVGISPFNGFTYDHLYGTKVGGTIFDRFGRRHTAAELLASSNPRNIHVLVRATVQK IEFDTTGKKPKAVGVIFKDEDGKTHRASLSKRVRSEIIVSCGAIGSPQMLLLSGIGPKSELEKFNIPVVVDNPFVGKNMSDNPLNTIFVPSSTPVNFSLIQTVGITKEGVYIESSSGYGQ SKDSIHCD | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 27,067.333 | ||
| Theoretical pI: | 8.810 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 44.263 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.246 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.290 | ||
| sheet | 0.185 | ||