| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330506.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
| ILDSHSPESFSGFFNLILLTRLFWICACDAPSNVGSFYFNFLLAPNIETFACRYAPVLRNFLVAAGTDVELCFMRTLGYMLAKWLVLRDVEVGLKAVTPLPSNNLGFSYAMESHGLWVLK GYAPVKSMQCQGQKSQFPWLIDARESLLKYALAHQQLEAVIQLEYTVQYHDNFIQVNARVDNLRIHVAKVGFKNNHSDESFLNEKHFSSRVRVWVGPEVGAGYVGGLSLGRSTDNTEEGN GDAKD | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,478.034 | ||
| Theoretical pI: | 6.179 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41160 | ||
| Instability index: | 40.196 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.245 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330506.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
| ILDSHSPESFSGFFNLILLTRLFWICACDAPSNVGSFYFNFLLAPNIETFACRYAPVLRNFLVAAGTDVELCFMRTLGYMLAKWLVLRDVEVGLKAVTPLPSNNLGFSYAMESHGLWVLK GYAPVKSMQCQGQKSQFPWLIDARESLLKYALAHQQLEAVIQLEYTVQYHDNFIQVNARVDNLRIHVAKVGFKNNHSDESFLNEKHFSSRVRVWVGPEVGAGYVGGLSLGRSTDNTEEGN GDAKD | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 27,478.034 | ||
| Theoretical pI: | 6.179 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41160 | ||
| Instability index: | 40.196 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.245 | ||
| sheet | 0.265 | ||