| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330529.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| SDKNPRQTKFSSSPPAKMANLRTAMDAAFWDLDISTPQAIDGVCKAIPGDPIPLDGAKASKALRFQQVSLLRNGFPLGIIPSFSPSINHKELGSFALQSLIGRAVIGDWWCGLIGQFRPK KLITSIRNEFSAAEEWELPLFKDAAKHFLNKSLYALGVCTQIPLSSSTSVLLNTEKHGENKNRRTKARLYHKLPDYDITVDAAWPELFIDRKGKYWEVPESISLDCLSLVSESGFRYRFG LHKNSGTPQAIDSVDT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,422.141 | ||
| Theoretical pI: | 8.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 40.461 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.270 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330529.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| SDKNPRQTKFSSSPPAKMANLRTAMDAAFWDLDISTPQAIDGVCKAIPGDPIPLDGAKASKALRFQQVSLLRNGFPLGIIPSFSPSINHKELGSFALQSLIGRAVIGDWWCGLIGQFRPK KLITSIRNEFSAAEEWELPLFKDAAKHFLNKSLYALGVCTQIPLSSSTSVLLNTEKHGENKNRRTKARLYHKLPDYDITVDAAWPELFIDRKGKYWEVPESISLDCLSLVSESGFRYRFG LHKNSGTPQAIDSVDT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,422.141 | ||
| Theoretical pI: | 8.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
| Instability index: | 40.461 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.270 | ||
| sheet | 0.238 | ||