| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330531.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| PMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFAED VAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVHGID VFDPKFNI | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 28,074.990 | ||
| Theoretical pI: | 5.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 28.948 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330531.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| PMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMIKRIKEQGLDITPRILIVTRLLPDAVGTTCGQKLEKVFGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFAED VAKEIAVELQGKPDLIIGNYSEGNLAASLLAHKLGVTQCTIAHALEKTKYPDSDIYLKKFDEKYHFSCQFTADLYAMNHTDFIITSTFQEIAGSKDTVGQYESHMAFTMPGLYRVVHGID VFDPKFNI | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 28,074.990 | ||
| Theoretical pI: | 5.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 28.948 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.083 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||