| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330535.1 | 3prime_partial | 217 | 101-751(+) |
Amino Acid sequence : | |||
| MDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWD DIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMSKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITAL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 25,244.462 | ||
| Theoretical pI: | 5.390 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48485 | ||
| Instability index: | 36.100 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.217 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330535.1 | 3prime_partial | 217 | 101-751(+) |
Amino Acid sequence : | |||
| MDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWD DIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMSKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITAL | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 25,244.462 | ||
| Theoretical pI: | 5.390 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48485 | ||
| Instability index: | 36.100 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.217 | ||
| sheet | 0.240 | ||