| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330549.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
| EELKKQGDPIEERYKEHTERGSVIDQLIYCINSYREVAMSNDTKFDHIDMAEKQKVLNECVEAEAWLREKKQHQESLPKHANPALLCADVRKKTEALDRFCRPIMTKPKPKPAKPEPASP APSQGGEPQPKEEAASSPAQNTDAGAGQEVPPAAAEPMETDTSQNA* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,416.390 | ||
| Theoretical pI: | 5.225 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 58.931 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.157 | ||
| turn | 0.229 | ||
| sheet | 0.319 | ||