Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330549.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
EELKKQGDPIEERYKEHTERGSVIDQLIYCINSYREVAMSNDTKFDHIDMAEKQKVLNECVEAEAWLREKKQHQESLPKHANPALLCADVRKKTEALDRFCRPIMTKPKPKPAKPEPASP APSQGGEPQPKEEAASSPAQNTDAGAGQEVPPAAAEPMETDTSQNA* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,416.390 | ||
Theoretical pI: | 5.225 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 58.931 | ||
aromaticity | 0.036 | ||
GRAVY | -1.039 | ||
Secondary Structure Fraction | |||
Helix | 0.157 | ||
turn | 0.229 | ||
sheet | 0.319 |