| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330556.1 | complete | 178 | 330-866(+) |
Amino Acid sequence : | |||
| MFSSPQILEDEDQHSNPSRTMISSSSNPAFNPESRLLCPRRTFSNPQVLEDEDQSPNSSNPTLDPELKLFSPGERFQVYKSLKIKIKVQEHEEQDRLLHQIQVKSSIRFRNKVQTLSVLH YQPLLSVSGILLKFACMGEKKFQSQLKSHAHFMLKTICMHVTTMTMTMTMTMVVGPCP* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,381.350 | ||
| Theoretical pI: | 8.707 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 57.888 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.258 | ||
| sheet | 0.236 | ||