Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330557.1 | internal | 290 | 3-872(+) |
Amino Acid sequence : | |||
TSQPPSQPPSTSTPTQSASDDVNPFSFWFYFTLFVSLITIFFILLSSLSTQDPKTWFLNLPPVLRRHYSDGRTIKVQTALNHPQVEVFSIQQGPVNADSRVLIVHGLGCSSFSFQDVVKS LGRRDVRAVAIDLPGSGFSDKSVVVVEENSGGSGPFGKMWDVYEEIKEKGLFWGFDQLVEQGYVDFEEDKKQASKKERVKPIELGSEEMGRVLGQVVDSMELAPVDLVLHDSALVLSANW ISENRGLIRSVVVLDGGIALPLWVLKVPVVREIVLGFRFVFERVLARCCV | |||
Physicochemical properties | |||
Number of amino acids: | 290 | ||
Molecular weight: | 11,494.854 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 34.809 | ||
aromaticity | 0.046 | ||
GRAVY | -0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.352 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330557.1 | 5prime_partial | 108 | 874-548(-) |
Amino Acid sequence : | |||
FTQHLARTLSNTNLNPNTISLTTGTFNTQRGNAIPPSRTTTLLIRPLFSEIQLALKTNAESCNTKSTGASSIESTTCPNTLPISSLPNSMGLTLSFLEACFLSSSKST* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,494.854 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 34.809 | ||
aromaticity | 0.046 | ||
GRAVY | -0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.352 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330557.1 | internal | 290 | 3-872(+) |
Amino Acid sequence : | |||
TSQPPSQPPSTSTPTQSASDDVNPFSFWFYFTLFVSLITIFFILLSSLSTQDPKTWFLNLPPVLRRHYSDGRTIKVQTALNHPQVEVFSIQQGPVNADSRVLIVHGLGCSSFSFQDVVKS LGRRDVRAVAIDLPGSGFSDKSVVVVEENSGGSGPFGKMWDVYEEIKEKGLFWGFDQLVEQGYVDFEEDKKQASKKERVKPIELGSEEMGRVLGQVVDSMELAPVDLVLHDSALVLSANW ISENRGLIRSVVVLDGGIALPLWVLKVPVVREIVLGFRFVFERVLARCCV | |||
Physicochemical properties | |||
Number of amino acids: | 290 | ||
Molecular weight: | 11,494.854 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 34.809 | ||
aromaticity | 0.046 | ||
GRAVY | -0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.352 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330557.1 | 5prime_partial | 108 | 874-548(-) |
Amino Acid sequence : | |||
FTQHLARTLSNTNLNPNTISLTTGTFNTQRGNAIPPSRTTTLLIRPLFSEIQLALKTNAESCNTKSTGASSIESTTCPNTLPISSLPNSMGLTLSFLEACFLSSSKST* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,494.854 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 34.809 | ||
aromaticity | 0.046 | ||
GRAVY | -0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.352 | ||
sheet | 0.241 |