| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330583.1 | 5prime_partial | 147 | 650-207(-) |
Amino Acid sequence : | |||
| AGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTA AYGHFGRDDPDFTWEVVKPLKWEKPQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 13,073.538 | ||
| Theoretical pI: | 4.607 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 52.999 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.282 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330583.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
| HSFIHSYNMVIPQHQHFLQNIMPFKFNTLINKKTKTQKSNKHHFEVKNPFITIYSIPHHPTIQPQQKTAQLCGFSHLSGFTTSHVKSGSSRPKCPYAAVFKNLPLLPLFRSRLIEIIPGL KSKLSFTIFRISLSGIFPVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,073.538 | ||
| Theoretical pI: | 4.607 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 52.999 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.282 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330583.1 | 3prime_partial | 124 | 279-650(+) |
Amino Acid sequence : | |||
| MPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVHKHRQRLRDTDGVRDLHDAPPCEPVGNDALGRLPDNVGATPVDLGGVLPGEGPAAVGPPPAVGVDDDLTA GETC | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,073.538 | ||
| Theoretical pI: | 4.607 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 52.999 | ||
| aromaticity | 0.000 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.282 | ||
| sheet | 0.258 | ||