Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330588.1 | 5prime_partial | 204 | 3-617(+) |
Amino Acid sequence : | |||
NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVLKPRSL* | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,947.376 | ||
Theoretical pI: | 7.237 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
Instability index: | 52.145 | ||
aromaticity | 0.069 | ||
GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.240 | ||
sheet | 0.289 |