| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330588.1 | 5prime_partial | 204 | 3-617(+) |
Amino Acid sequence : | |||
| NINVAAIETTLWSIEWGIAELVNHPHIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERF LEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVLKPRSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,947.376 | ||
| Theoretical pI: | 7.237 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 52.145 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.240 | ||
| sheet | 0.289 | ||