| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330591.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| NIEKRNNDPKPDSLASKLPQKEGSIPCTDGKTSGEVHGSSSDGEKLLHKKCKSLAENTAEKSLKSADPVRRPVPVSERDREKRNGILGKSMDAWKEKRNWEDILAIPPRVSSRFSYSPGL NRKSAERGRVLHDKLMSPEKKKKSAPDLKKKAEEKHARATRIRAQLEHERVQRLQRTSEKLNRVSEWQTVRSNKLRESMFARHQRSESRHEAYIAXVVRRAGDETSKVNEVRFITSLNEE NKKHILRKKLHDSELRRAEKLQVIKTKQKEGLAR | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 31,454.431 | ||
| Theoretical pI: | 10.215 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.292 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330591.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| NIEKRNNDPKPDSLASKLPQKEGSIPCTDGKTSGEVHGSSSDGEKLLHKKCKSLAENTAEKSLKSADPVRRPVPVSERDREKRNGILGKSMDAWKEKRNWEDILAIPPRVSSRFSYSPGL NRKSAERGRVLHDKLMSPEKKKKSAPDLKKKAEEKHARATRIRAQLEHERVQRLQRTSEKLNRVSEWQTVRSNKLRESMFARHQRSESRHEAYIAXVVRRAGDETSKVNEVRFITSLNEE NKKHILRKKLHDSELRRAEKLQVIKTKQKEGLAR | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 31,454.431 | ||
| Theoretical pI: | 10.215 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 56.292 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.236 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||