| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330592.1 | internal | 221 | 663-1(-) |
Amino Acid sequence : | |||
| EVYIAQVVRRAGDETSKVNEVRFITSLNEENKKHILRKKLHDFELRRAEKLQVIKTKQKEDMAREEAVLERKRLIEAEKLQRLAETQRRKEEAQVRREEERKASSAAREAKAMEQMRRKE IRAKAQQEEAELLAQKLAEKLRESYQRRKFYLEQIRERASMDFRDQSSPLLRRFASKEGQTQAQVRLAPYNNGDDNPTNDGSCASGTGISEALQHSLKRRI | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 25,963.106 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 65.334 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.131 | ||
| sheet | 0.353 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330592.1 | internal | 221 | 663-1(-) |
Amino Acid sequence : | |||
| EVYIAQVVRRAGDETSKVNEVRFITSLNEENKKHILRKKLHDFELRRAEKLQVIKTKQKEDMAREEAVLERKRLIEAEKLQRLAETQRRKEEAQVRREEERKASSAAREAKAMEQMRRKE IRAKAQQEEAELLAQKLAEKLRESYQRRKFYLEQIRERASMDFRDQSSPLLRRFASKEGQTQAQVRLAPYNNGDDNPTNDGSCASGTGISEALQHSLKRRI | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 25,963.106 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 65.334 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.131 | ||
| sheet | 0.353 | ||