| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330594.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| FRRAQSDGNLEGLADVSYNVDEFSLARKSGRRNSICTLESIPSISAHRLRSSFEDDSGDDEGFEEEEEDENGGYGWSPTVVENLVLEKVGSRGHEIGNGGVGLQREGKMYLAAGIGALGV DFAVGDGNGGGGGGRGSYRPVDFNREGGDSGGVSMEEHYKRMLEQNPGDPLFLRNYAHFLYQIKGDVGAAEEYYSRAILTDQEDGETLSQYAKLIWETQHDRERAATYFQRAVRLSSHDS HIHAAY | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 13,929.843 | ||
| Theoretical pI: | 8.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 42.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.242 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330594.1 | complete | 124 | 475-101(-) |
Amino Acid sequence : | |||
| MFLHTHTAAIAALPVEIHRPITPSPASSAAVPVTHREIHSQRSNPCRQIHFPLSLQPYTAIPNLMPSTPHFFQNQILHHCRTPTISTIFIFFLFFKSFIITAVVFEGTPESVRGDRGDRF QGAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,929.843 | ||
| Theoretical pI: | 8.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 42.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.242 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330594.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| FRRAQSDGNLEGLADVSYNVDEFSLARKSGRRNSICTLESIPSISAHRLRSSFEDDSGDDEGFEEEEEDENGGYGWSPTVVENLVLEKVGSRGHEIGNGGVGLQREGKMYLAAGIGALGV DFAVGDGNGGGGGGRGSYRPVDFNREGGDSGGVSMEEHYKRMLEQNPGDPLFLRNYAHFLYQIKGDVGAAEEYYSRAILTDQEDGETLSQYAKLIWETQHDRERAATYFQRAVRLSSHDS HIHAAY | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 13,929.843 | ||
| Theoretical pI: | 8.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 42.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.242 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330594.1 | complete | 124 | 475-101(-) |
Amino Acid sequence : | |||
| MFLHTHTAAIAALPVEIHRPITPSPASSAAVPVTHREIHSQRSNPCRQIHFPLSLQPYTAIPNLMPSTPHFFQNQILHHCRTPTISTIFIFFLFFKSFIITAVVFEGTPESVRGDRGDRF QGAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,929.843 | ||
| Theoretical pI: | 8.890 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 42.181 | ||
| aromaticity | 0.105 | ||
| GRAVY | 0.017 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.242 | ||
| sheet | 0.185 | ||