| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330597.1 | internal | 218 | 654-1(-) |
Amino Acid sequence : | |||
| DNKPVSLPTATVDAPAPPVGALSKALTRLQASRKFRQLREAAKGVTKQMGNQTHEIASKVDAYLKGMTGKPGTSLFEELGIYYIGPVDGHSLEDLVHIFKKVKEMPAPGPVLIHIITEKG KGYPPAEAAADKMHGVVKFDPTTGKQMKAKTNTKSYTQYFAESLVAEAEQDEKIVAIHAAMGGGTGLNIFQKRFPERCFDVGIAEQHAVTFAAGLATE | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,432.643 | ||
| Theoretical pI: | 8.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 40.128 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.211 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330597.1 | internal | 218 | 654-1(-) |
Amino Acid sequence : | |||
| DNKPVSLPTATVDAPAPPVGALSKALTRLQASRKFRQLREAAKGVTKQMGNQTHEIASKVDAYLKGMTGKPGTSLFEELGIYYIGPVDGHSLEDLVHIFKKVKEMPAPGPVLIHIITEKG KGYPPAEAAADKMHGVVKFDPTTGKQMKAKTNTKSYTQYFAESLVAEAEQDEKIVAIHAAMGGGTGLNIFQKRFPERCFDVGIAEQHAVTFAAGLATE | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 23,432.643 | ||
| Theoretical pI: | 8.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
| Instability index: | 40.128 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.211 | ||
| sheet | 0.284 | ||