| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330602.1 | complete | 167 | 87-590(+) |
Amino Acid sequence : | |||
| MNKAKYNKRAKPCSIQKRKKLQEINNERLLLCSDLLRTNQPRQPSISTRLLDQSGGAFRAHNLGRLLPVPRRPVASLLRHAQILHQGSGVLAMSSFSNSFGRHTTMVVRRLKKFFKLGFH IQDLLINAEIEVIRQLNDVVSIFLLSENVLLLVLAQPKIAEPSGGGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 17,644.506 | ||
| Theoretical pI: | 4.815 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 48.285 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.632 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.263 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330602.1 | complete | 156 | 695-225(-) |
Amino Acid sequence : | |||
| MALVSGGRSSLNPNAPLFIPAAVRQVEDFSPEWWNLVTTATWFRDFWLSEHQEEDIFGEEKDGNDVVELPDNFDLGVDEEILNMEAQFEEFLQSSDYHGSMPAKGITETAHGKNTRALVK NLSMPKERGNGATRNWEKPAKIVSPKCTPRLIQQPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,644.506 | ||
| Theoretical pI: | 4.815 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 48.285 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.632 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.263 | ||
| sheet | 0.276 | ||