Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330606.1 | 5prime_partial | 179 | 2-541(+) |
Amino Acid sequence : | |||
GHANEPQSFTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFASDIVRYFKELQPDAQSWLVKS NPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 11,377.167 | ||
Theoretical pI: | 8.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 34.912 | ||
aromaticity | 0.121 | ||
GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.273 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330606.1 | complete | 99 | 430-131(-) |
Amino Acid sequence : | |||
MPYIKAISDIQSNPWCIPSQNWIGLDQPTLCIWLEFFEISNNVTGKGFSTLPPCHILENRICRTLVQVLKHSCNFSWAKFHRLVSYGCSVINSIACIYR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,377.167 | ||
Theoretical pI: | 8.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 34.912 | ||
aromaticity | 0.121 | ||
GRAVY | 0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.273 | ||
sheet | 0.152 |