| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330615.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| WSQNAIQATYAWLREGLKQRCITRDLKWGVPVPHENFKEKVFYVWFDAPIGYVSITACHTPEWEKWWKNPENVELYQFMGKDNVPFHTVIFPSTLIGTGENWTMMKTISVTEYLNYEAGK FSKSKGVGVFGNDVKDTIIPVEVWRYYLLTNRPEVSDTLFTWSDLQAKLNSELLSNLGNFVNRVLSFIAKDPASGYGSVIPDAPGADSHSLTKALGDKVGSYVEQYVEAMEKVKLKQGLK MP | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,559.126 | ||
| Theoretical pI: | 6.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 71390 71515 | ||
| Instability index: | 21.497 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.244 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330615.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| WSQNAIQATYAWLREGLKQRCITRDLKWGVPVPHENFKEKVFYVWFDAPIGYVSITACHTPEWEKWWKNPENVELYQFMGKDNVPFHTVIFPSTLIGTGENWTMMKTISVTEYLNYEAGK FSKSKGVGVFGNDVKDTIIPVEVWRYYLLTNRPEVSDTLFTWSDLQAKLNSELLSNLGNFVNRVLSFIAKDPASGYGSVIPDAPGADSHSLTKALGDKVGSYVEQYVEAMEKVKLKQGLK MP | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 27,559.126 | ||
| Theoretical pI: | 6.501 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 71390 71515 | ||
| Instability index: | 21.497 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.244 | ||
| sheet | 0.219 | ||